PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g069310.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 132aa    MW: 14678.4 Da    PI: 4.2503
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g069310.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB57.24e-182672186
               NF-YB 21 lPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                        lP + ++++d+++++ ec +efi +++se+++ c+re+++ti+++ +l al  lGf +y+e++ + 
  Solyc06g069310.2.1  2 LPPDVRVARDTQDLLIECCVEFINLISSESNEVCNREEKRTIAPEHVLKALQVLGFGEYIEEVYAA 67
                        8999*********************************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.4E-302112IPR009072Histone-fold
SuperFamilySSF471131.04E-263113IPR009072Histone-fold
PfamPF008083.5E-14452IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MLPPDVRVAR DTQDLLIECC VEFINLISSE SNEVCNREEK RTIAPEHVLK ALQVLGFGEY  60
IEEVYAAYEQ HKLETMDTVR AGKCSNGAEM TEEEALAEQQ RMFAEARARM NGGVTGPPKQ  120
QDSEAEQTLN S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B4e-30410730133Transcription Regulator NC2 beta chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.213730.0fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241619.15e-94PREDICTED: protein Dr1 homolog
RefseqXP_006354739.15e-94PREDICTED: protein Dr1 homolog
RefseqXP_015077062.15e-94PREDICTED: protein Dr1 homolog
SwissprotP495924e-71NC2B_ARATH; Protein Dr1 homolog
TrEMBLM0ZY195e-94M0ZY19_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000104361e-93(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38202244
Representative plantOGRP34491727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.44e-74nuclear factor Y, subunit B13